2. Signaling Pathways
  3. Metabolic Enzyme/Protease
  4. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Related Products

PDF 1.4 MB

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-N7450
    Icariside D2
    		Inhibitor ≥98.0%
    Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
    Icariside D2
  • HY-P3141
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • HY-A0043A
    Cilazapril monohydrate
    		Inhibitor 99.94%
    Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril monohydrate
  • HY-P0266A
    N-Acetyl-Ser-Asp-Lys-Pro TFA
    N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE.
    N-Acetyl-Ser-Asp-Lys-Pro TFA
  • HY-127026
    Quinaprilat
    		Inhibitor
    Quinaprilat is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat acts as anti-hypertensive agent and vasodilator.
    Quinaprilat
  • HY-18206S
    Lisinopril-d5
    		Inhibitor
    Lisinopril-d5 is the deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.
    Lisinopril-d<sub>5</sub>
  • HY-B0231BS
    Enalaprilat-d5 sodium
    		Inhibitor ≥98.0%
    Enalaprilat-d5 (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalaprilat-d<sub>5</sub> sodium
  • HY-B0592R
    Trandolapril (Standard)
    		Inhibitor
    Trandolapril (Standard) is the analytical standard of Trandolapril. This product is intended for research and analytical applications. Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI).
    Trandolapril (Standard)
  • HY-U00074
    Rentiapril racemate
    		Inhibitor 98.96%
    Rentiapril racemate (SA-446 racemate) is the racemate of Rentiapril. Rentiapril is an angiotensin converting enzyme (ACE) inhibitor.
    Rentiapril racemate
  • HY-N9528
    Lyciumin A
    		Inhibitor ≥99.0%
    Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
    Lyciumin A
  • HY-A0043
    Cilazapril
    		Inhibitor
    Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril
  • HY-18207
    Fasidotril
    		Inhibitor
    Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential research of hypertension and congestive heart failure (CHF).
    Fasidotril
  • HY-B0690
    Fosinopril
    		Inhibitor
    Fosinopril (SQ28555 free acid) is the ester proagent of angiotensin-converting enzyme (ACE) inhibitor with an IC50 value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an Ki value of 1.675 μM.
    Fosinopril
  • HY-118472S
    Benazeprilat-d5
    Benazeprilat-d5 is the deuterium labeled Benazeprilat[1].
    Benazeprilat-d<sub>5</sub>
  • HY-N2165R
    Vicenin 2 (Standard)
    		Inhibitor
    Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium.
    Vicenin 2 (Standard)
  • HY-B0130AR
    Perindopril (erbumine) (Standard)
    Perindopril (erbumine) (Standard) is the analytical standard of Perindopril (erbumine). This product is intended for research and analytical applications. Perindopril erbumine is an angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NF-κB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure.
    Perindopril (erbumine) (Standard)
  • HY-P4279
    Ovalbumin (154-159)
    		Inhibitor
    Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent angiotensin-converting enzyme (ACE) inhibitor. Ovalbumin (154-159) can be used for research of hypertension.
    Ovalbumin (154-159)
  • HY-B0592S
    Trandolapril-d5
    		Inhibitor
    Trandolapril-d5 is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].
    Trandolapril-d<sub>5</sub>
  • HY-N2021
    Phosphoramidon
    		Inhibitor
    Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC50 of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC50 values of 3.5, 0.034, and 78 μM, respectively.
    Phosphoramidon
  • HY-121550
    ME3221
    		Antagonist
    ME3221 is an angiotensin AT1 receptor antagonist that effectively antagonizes the pressor response to angiotensin II in rats and marmosets without affecting the hypotensive response to bradykinin. It demonstrates potent antihypertensive effects in renal hypertensive rats and spontaneously hypertensive rats (SHR), with efficacy comparable to or better than losartan in vivo. ME3221's repeated administration in SHR results in sustained and stable hypotensive effects without affecting heart rate, indicating its potential for treating both renal and essential hypertension similarly to losartan.
    ME3221
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity